Bienvenue à cgheute

Random Post Refresh

FMX 2010 – Chaos Group Presentation

Die Chaos Group mit einem vollem Programm rund um VRay und VR auf der FMX 2010… V-Ray Presentations – V-Ray Workshop – Exclusive sessions on...
Lire la suite ...
Members Login
Pas un membre?

L'adhésion est gratuite, mais vous offre plusieurs avantages:

1) Du kannst ein eigenes Artist-Profil anlegen und Bilder hochladen, avec lesquels vous pouvez vous présenter sur cette page.

Artistes ou comment d'autres peuvent également évaluer votre entreprise de travaux et si nécessaire contacter pour vous.

2) Du hast als registrierter User die Möglichkeit, Pour évaluer les entreprises et ensuite dire aux autres de votre expérience.

3) Als registrierter User kannst du Jobs sowie andere Nachrichten im Forum posten.

4) Du erhältst einmal im Monat eine VFX-News E-Mail und ein Update über neue Jobs.

Pour vous inscrire

Mot de passe!
Traduction
Traduction
 Modifier la traduction
par Transposh
Jan 28


ACTING FOR ANIMATORS NEWSLETTER – Januar 2011

A SMILE IS NOT JUST A SMILE

There is an interesting article about smiling ( “More to a Smile Than Lips and Teeth”, by Carl Zimmer) in the Science section of the January 25th New York Times.  Normal humans don’t need to think about stuff like this, but animators must.  The article provides an overview of research being conducted by the respected social psychologist Dr. Paula Niedenthal.  I like it because her conclusions fit hand-in-glove with theories about empathy that I teach in my master classes.  You might have to “join” the New York Times to access it, but it is free to do so and, anyway, you probably ought to already be reading that newspaper.  I have been a subscriber for forty years.  Anyway, if you can, I recommend that you read the entire article.  Here are a few major points that I took away from it:

1) There are many different kinds of smiles, some with teeth showing, some with chin dropped, and so on.

2) A smile is usually a factor of mood but can be a power play.

3) The other person’s perception of a smile is as important as the person doing the smiling.  We mimic one another’s smiles and, when we do, our brains are triggered to simulate the emotion of the smiler.  A genuine smile stimulates the reward centers in our brain, and a false one does not.  We refer to this intimate social interaction as “empathy”, but there is plenty of science behind it.

4) Charles Darwin studied the human smile, trying to determine its purpose in evolution.  He observed that chimpanzees have a kind of smile, when being social or when trying to establish dominance.  The human smile likely has similar purpose.


HIGH FIVES TO SHERIDAN’S ANIMATORS

We had a terrific Acting for Animators master class at Sheridan Institute near Toronto, Canada a few days ago.  I have wanted to teach there for a long time and had a marvelous time.  You can tell right away, simply by walking down the hallways, that there is a lot of talent in the school.  That perception was verified for me during dinner with some faculty members who explained how high are the admission standards.  The more I do what I do, the more convinced I am that energetic pre-screening is an important key to the success of any animation training program.  You can teach technique, but you can only encourage talent.  Thank you, people, for spending a day with me and for being such wonderful hosts.


ACTING FOR ANIMATORS WORKSHOP SCHEDULE

Jan 29         Montreal, Canada Cegep du Vieux Montreal

Feb 7-11     Teesside, England, Animex

Feb 26        Vancouver, Canada, Rainmaker Entertainment

Mar 3          Porto, Portugal, Catholic University of Porto

Apr 26-28   Ludwigsberg, Germany, Filmakademie Baden-Wurttemberg

May 3-6      Stuttgart, Germany, FMX 2011


CRAFT NOTES

LISTENING: A FRESH PERSPECTIVE

Listening may not be what you think it is.  What is your understanding of it?  In a conversation, you listen to the other person, and then she listens to you, right?  You take turns listening, and it is rude to interrupt, like your mama told you.  What if I said that two people in conversation are taking turns talking instead of listening?  Yes, that is the fact of the matter, and the distinction could make a difference to your character animation.


Roger Schank, a former professor at Yale and Northwestern Universities, earned his early reputation in the field of Artificial Intelligence.  That in turn led him to re-consider exactly how it is that we humans think. And that led to the ideas he put forth in Tell Me a Story -Narrative and Intelligence – (Northwestern University Press, 1990. ISBN 0-8101-1313-9, US$23 on Amazon.com).  These days, Mr. Schank is mainly focused on improving the K-12 educational system so that it better takes into account the role that he contends storytelling plays in learning.  You can read about that on this website.


In a nutshell, according to Schank, we humans are story-based.  Beginning as an infant, you experience things and tell yourself stories about them and, throughout your life, you expand, update and revise those stories.  By the time you are an adult, the stories are densely cross-referenced.  If, for instance, I tell you about the wonderful Thai restaurant where I had dinner last night, the moment you hear “Thai restaurant”, you will start mentally running through your own stories, cross-referencing to Thai restaurants you have enjoyed (or not), which may in turn cross-reference to your trip to Thailand.  This process happens faster than the blink of an eye, and you immediately have a story to tell me as soon as it is your turn.  You are only partially listening to me now because you have that story ready, and you are deciding not to interrupt.


Now, here is a Roger Schank premise that might surprise you:  You cannot learn what you do not already know.  This is why you don’t talk to non-industry friends about the mathmatics involved in 3D animation.  They don’t know anything about it and therefore won’t relate.  I have friends involved in genetic research, and all we talk about when we get together are the events of the day and which team is going to the World Series.  Put another way, you can’t understand the concept of “furniture” unless you first understand “table” and “chair”.


Stage actors spend a lot of time learning how to listen.  A very popular approach to acting training is called the Meisner Technique, formulated by the late Sanford Meisner.  A key element of the Meisner Technique involves “the repetition exercise” in which the actor learns to listen and repeat, then to listen and react.  Really, what they are learning is how to be “present”, to pay attention.  I don’t have a reliable statistic, but I will bet that we do not focus on 75 percent of what we hear in a day.  Listening to music can be relaxing if you are really listening to it, paying attention.


Animators often find it easiest to endow the speaking character in a two-character sequence with the illusion of life.  The one that is talking provides you with something to animate, namely words.  But what about the other character, the one who is silently listening?   The trick – and the point of these craft notes – is to remember that the character listening is mentally at least as busy as the character that is talking. He is busy cross-indexing, getting ready with his own story.  In animation for little kids, it may not matter all that much if the listener has a blank expression, but virtually all video games and feature animation will be improved if this adjustment is made.  One more time:  We take turns talking; we don’t take turns listening.


until next month …

Be safe!

http://www.actingforanimators.com

http://www.edhooks.com

home | top

filterfrontbridlegunnihomearosakisuefarawayrobkumaidithroland_pfisterergambitfilterfrontfhkaiserslauternaruyinnpolymaniacanillusionsuenataliiakhirnasvenartfarawaymacxspectralursproductionssuesvoigtpawlobenjaminmbastudiosdirk_wcamoxsyykum_svoigtbettina_gruenefeldtfilterfrontfarbkornmbastudiosmskyjoebsuesesquatchmoolikbildbotschaftmauricedubmaestrorobertusalexrtheeifrigdirkwanselmsimonmbastudiosclayjustinatarekjsamaanbrainspoonkonstantinmeyerandrehauptmarco_hayek
cgheute.png
Blog Profil de l'artiste Forums Base de données Sondages VFX Company Videos Shop À propos de Contactez-nous Mentions légales Confidentialité
Nouvelles
Interviews
Evénements
Tutoriels
Critiques
Ressources
Films

Evénements
Festivals
Education
Logiciels
Films en 3D
Game Developers
BluRays
Livres
Glossar

VFX Branche
VFX Firmen
VFX Gehaltsspiegel
VFX Ausbildung
VFX Software
VFX Filme
Munich
Berlin
Hambourg
Francfort sur le Main
Cologne / Dusseldorf
Stuttgart
Ailleurs

Blurays
Spiele
Logiciels
Appareil photo
Shirts



E-Mail
Soumettre Nouvelles
Annonceurs